<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1288 CA3162 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 4
2 3TC+AZT 26
3 3TC+AZT+IDV 43
4 AZT+DDI+IDV+NVP 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I L10I, E34Q, N37A, R41K, I62V, L63A, A71V, V77I, I93L  
>CA3162| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLQEMALPGKWKPKMIGGIGGFVKVRQYD
QVAIEICGHKVIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V   K103N, G190GA   T27TS, K122E, D123N, I135IT, T200TS, Q207E, R211K, F214L, V245T, K277R, V292I, I293V, E297A  
>CA3161| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRSKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEIVPLTAEAE
LE

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005