<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RenG13958 RenG13958 Brazil 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46IK, I54V, L76V, V82F, L90M L33I, K43T, G48E L5F, L10V, T12S, I13V, L19I, K20V, E35D, M36I, N37S, R57RK, I62V, L63P, I64V, H69K, A71V, I72V, I85V  
>RenG13958| codons 4-99
TFWQRPVVSVKIGGQIVEALLDTGADDTVIEDISLPGRWTPKKIEGIGGFVKVKQYDQVP
VEICGKKVVGTVVVGPTPFNIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115YF, Q151M, M184V A62V, V75I, F116Y, K219Q     V60I, S68G, T69I, V118I, K122E, I135T, T165I, E169D, G196E, T200A, F214L L209M
>RenG13958| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFVIKRKDGIKWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAFYSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQSSMIKILDPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRAKIEELRQHMLRWGLTTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Diaz, RS The virological and immunological characteristics of the HIV-1-infected population in Brazil: from initial diagnosis to impact of antiretroviral use. PLoS ONE, 2015