<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1286 CA3157 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 NRTI 34
3 3TC+AZT 43
4 3TC+AZT+SQV 65
5 3TC+AZT+NFV 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R       T69S, I135IV, K166R, D177E, R211K, K277R, I293V  
>CA3157| codons 1-296
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35D, N37S, I62V, L63A, V77I  
>CA3158| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005