<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RenG15172 RenG15172 Brazil 2008 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A, L90M L33F, F53L, T74P L10I, I13V, K20R, E34A, E35D, M36I, R41K, K45KR, K55R, R57K, Q61N, L63S, C67E, I72V, V77I G16GDE
>RenG15172| codons 4-99
TLWQRPIVTVKIEGQLREALLDTGADDTIFADINLPGKWKPRIVGGIGGLMRVKQYDNIS
IEIEGHKAVGPVLIGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F V75M, K219Q K103N V108I, K238T T39Q, V60I, V90I, D123E, I135T, S162Y, E169D, K173A, Q174K, T200A, E203K, Q207D, H208Y, R211K, K223EQ, L228H, V245T  
>RenG15172| codons 38-247
CQELEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLMDFRELNKRTQDFWEIQLGIPHP
AGLKKNKSVTILDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILDPFRAKNPDIVIYQYVDDLYVGSDLEIGQHRAKIKELRDYLLKWGFFTP
DQKHQQEPPFHWMGYELHPDTWTVQPITLP

References
Author Title Citation
Diaz, RS The virological and immunological characteristics of the HIV-1-infected population in Brazil: from initial diagnosis to impact of antiretroviral use. PLoS ONE, 2015