<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RenG13841 RenG13841 Brazil 2009 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TKPQ, K14Q, K20R, E35D, M36I, N37ND, R41K, R57RK, D60E, Q61N, I62V, L63S, E65EDKN, L89LM  
>RenG13841| codons 4-99
TLWQRPLVQIQIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYENVS
INICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215TNSY       V106VI, I135AT, N175Y, I178M, T200E, K201R, R211K  
>RenG13841| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQYPDMVIYQYMDDLYVGSDLEIGQHRERIEELRQHLLKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Diaz, RS The virological and immunological characteristics of the HIV-1-infected population in Brazil: from initial diagnosis to impact of antiretroviral use. PLoS ONE, 2015