<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA596 CA3146 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+DDI 52
3 DDI 222
4 D4T 17
5 3TC+D4T 26
6 3TC+AZT 48
7 D4T+NFV 26
8 3TC+AZT+SQV 18
9 3TC+D4T+IDV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I84V, L90M G73GC L10I, K20I, E35D, M36I, I62V, L63P, I64V  
>CA3146| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPVEICGHKAICTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005