Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA596 | CA3146 | U.S. | 1997 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 52 |
| 2 | AZT+DDI | 52 |
| 3 | DDI | 222 |
| 4 | D4T | 17 |
| 5 | 3TC+D4T | 26 |
| 6 | 3TC+AZT | 48 |
| 7 | D4T+NFV | 26 |
| 8 | 3TC+AZT+SQV | 18 |
| 9 | 3TC+D4T+IDV | 48 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46MI, I84V, L90M | G73GC | L10I, K20I, E35D, M36I, I62V, L63P, I64V |
| >CA3146| codons 1-99 PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD QVPVEICGHKAICTVLVGPTPVNVIGRNLMTQIGCTLNF |
References
| Author | Title | Citation |
| Zolopa, AR | HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. | Ann Intern Med, 1999 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |