<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE790 SE790 Uganda 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None 52
2 NVP 1
3 None 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN   K11T, K20R, V21I, V35T, K122E, D123S, K173S, D177G, V179I, T200A, I202V, Q207A, R211S, V245Q, V261I, T286A, E291D, V292I, I293V, P294T, E312D E248C
>SE790| codons 1-321
PISPIETVPVTLKPGMDGPRIKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPGIII
YQYMDDLYVGSDLEIGQHRAKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPCKDSWTVNDIQKLIGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGVYYDP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>SE790| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Eshleman, SH Impact of human immunodeficiency virus type 1 (hiv-1) subtype on women receiving single-dose nevirapine prophylaxis to prevent hiv-1 vertical transmission (HIV network for prevention trials 012 study). J Infect Dis, 2001
Eshleman, SH Survival of Ugandan infants with subtype A and D HIV-1 infection (HIVNET 012). JAIDS, 2002
Eshleman, SH Comparison of nevirapine (NVP) resistance in Ugandan women 7 days vs. 6-8 weeks after single-dose nvp prophylaxis: HIVNET 012. ARHR, 2004
Eshleman, SH Identification of Ugandan HIV type 1 variants with unique patterns of recombination in pol involving subtypes A and D. ARHR, 2002