<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RenG14039 RenG14039 Brazil 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L23I, L24I, L33F L10I, I13V, I15V, G16E, L19I, M36L, N37T, P39S, R41K, G51A, K55KR, I62V, L63T, I72T, T74A, L89M  
>RenG14039| codons 4-99
TLWQRPIVTVKVEGQIKEAIIDTGADDTVFEELTLSGKWKPKLIGGIAGFVRVRQYDQVT
IEICGHKATGAVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W, T215Y V75L, K219N G190Q   T39E, E44D, V60I, K102R, V118I, D121Y, K122E, I135T, V179I, G196E, Q197E, T200S, E203K, Q207E, H208Y, R211K, K223Q, L228H, Q242L  
>RenG14039| codons 38-247
CEELEKDGKISKIGPENPYNTPIFAIKKKNSTKWRKLLDFRELNKRTQDFWEVQLGIPHP
AGLKRKKSVTVLDVGDAYFSIPLYEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYIDDLYVQSDLEIEEHRSKIKELREYLWKWGFYTP
DNKHQQEPPFHWMGYELHPDKWTVLPIVLP

References
Author Title Citation
Diaz, RS The virological and immunological characteristics of the HIV-1-infected population in Brazil: from initial diagnosis to impact of antiretroviral use. PLoS ONE, 2015