<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA635 CA3142 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 21
2 AZT+DDC 35
3 3TC+AZT 31
4 3TC+AZT+D4T 13
5 3TC+AZT+IDV 4
6 D4T+DDI+SQV 39
7 D4T+DDI+RTV+SQV 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V L10LF, I47IL, G73S E34D, M36I, R41RS, K43KN, I62V, L63P, A71AV, I93L  
>CA3142| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLDEINLPGSWNPKMLGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184MV, T215F K219Q   A98G K64KR, D123E, I135T, Q207K, F214L, T286A, K287R  
>CA3141| codons 1-292
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRKHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGARALTEV

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005