<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR020 8200 Brazil 2000 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NFV 26
2 RTV+ EFV+ DDI+ D4T+ SQV 8
3 EFV+ 3TC+ D4T+ SQV+ RTV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15X, G16E, E35D, M36I, P39T, R41K, R57K, Q61N, L63V, L89M  
>8200| codons 13-99
IRXEGQLKEALLDTGADDTVLEDINLTGKWKPKMIGGIGGFIKVKQYDNIVIEICGHKAI
GTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215F       I135V, S162C, K173A, Q174K, T200A, Q207D, R211K, V241E Y232I
>8200| codons 33-244
ALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQG
WKGSPAIFQCSMTKILEPFRAKNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELRDHLLKW
GFFTPDKKHQKEPPFLWMGIELHPDKWTEQPI

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005