<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR039 10000 Brazil 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTV+ SQV+ D4T+ DDI 52
2 AZT+ NFV+ 3TC+ NVP 32
3 IDV+ D4T+ ABC+ RTV 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A K43T L10I, E35D, M36I, I62V, L63P, I64V, H69Q  
>10000| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGRWTPKMIVGIGGFVKVRQYD
QVPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, L210W, T215Y K219R V106A F227L E28X, K43E, E44A, V118I, K122E, I178M, T200K, E203D, H208Y, R211K, H221Y L12F, L26F
>10000| codons 9-239
PVKFKPGMDGPKVKQWPFTDEKIKALVEICTELEEAGKISKIGPENPYNTPVFAIKKKNS
TKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSIPLDEDFRKYT
AFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVIYQYMDDLY
VGSDLEIGQHRKKIDELRQYLWKWGFYTPDRKYQKEPPLLWMGYELHPDKW

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005