<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR052 14200 Brazil 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 17
2 D4T+ 3TC+ IDV 56
3 RTV+ D4T+ DDI 68

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, V82VA, I84V, L90M G73GS L10I, R57RK, L63P, A71X  
>14200| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVKQYD
QIPIEICGHKXISTVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       K73X, L74X, K122E, I142V, S162Y, Q197E, T200I, V245L, A272P, T286A, I293V, E297R, D324E  
>14200| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRNXVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGEHRIKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTREAE
LELAENREILKEPVHGVYYDPSKE

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005