<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR018 1201 Brazil 2001 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 26
2 NVP+ RTV+ D4T+ 3TC 26
3 DDI+ EFV+ AZT+ NFV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70KR, T215Y V75VL K101KE, Y181C, G190GA   E28K, V35T, D123E, I135T, S162SC, E169A, K173A, Q174K, D177E, G196E, Q207A, R211T, V245Q, D250E  
>1201| codons 4-250
PIETVPVKLKPGMDGPKVKQWPLTKEKIKALTEICTEMEKEGKISKIGPENPYNTPVFAI
KKKNSTRWRKLLDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDKE
FRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILAPFRAKNPEIVICQY
MDDLYVASDLEIEQHRTKIEELRAHLLTWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQP
IQLPEKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, V82VA   L10I, I15V, Q18L, K20KR, E35D, M36I, R41K, R57K, D60E, Q61N, L63T, C67X, H69Q, I72T, L89M  
>1201| codons 1-99
PQITLWQRPIVTIKVGGLLREALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVKQYE
NITIEIXGQKATGTVLVGPTPANIIGRNMLTQIGCTLNF

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005