<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA634 CA3138 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 AZT+DDI 157
3 D4T 104
4 AZT+DDC+SQV 13
5 3TC+D4T+IDV 56

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       K43E, E44A, W88C, V118I, I135V, I142V, K166KR, D177E, I178M, G196E, T200TA, E203D, H208Y, R211X  
>CA3138| codons 1-254
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEMVI
YQYVDDLYVGSDLEIEQHRAKIDELRQYLWXWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, K20R, E35D, M36I, N37D, I62V, L63P, A71V, V77I, I93L  
>CA3139| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKMIVGIGGFTKVRQYD
QVPIEICGHKVIGTVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005