<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR033 6801 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ D4T+ DDI+ NVP 60
2 3TC+ APV+ D4T 52
3 LPV+ D4T+ 3TC 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, I84V K43T L10I, I13V, L19LR, K20M, M36I, I62V, L63P, I64V, T74A, T91S  
>6801| codons 1-99
PQITLWQRPIVTVKIGGQRMEALLDTGADDTVLEEINLPGRWTPKMIVGIGGFVKVRQYD
QVPVEICGHKAIGAVLVGPTPANVIGRNLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151M, M184V, T215F F116Y, K219Q Y181C, G190GA   K20R, V35I, K43KN, A98S, V108X, L109I, K122E, D123E, I135T, K166KQ, I167V, T200A, I202V, D218E, E224ED, L228H, A272P, K277R, L283I, I293V  
>6801| codons 1-324
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMENEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTXIDVGDAYYSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTQVLEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRAKVEELRQHLLRWGFFTPEQKHQKDPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005