<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR016 9099 Brazil 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ AZT+ DDI 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12I, I13V, I15V, L19LI, E35D, M36I, R41K, R57K, Q61N, I72T, L89LM  
>9099| codons 1-99
PQITLWQRPVVIVKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIEICGHKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005