<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR015 10700 Brazil 2000 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT 106
2 DDI+ NFV+ D4T 45
3 DDI+ RTV+ SQV+ D4T 10

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, G16E, E35D, M36I, R41K, R57K, D60E, Q61N, L63A, I72E, L89M G52K, G86K
>10700| codons 13-99
IRVEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGKFIKVKQYENIAIEICGHKAE
GTVLVGPTPVNIIKRNMLTQIGCTLNF

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005