<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR013 80397 Brazil 1997 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 43
2 DDI+ AZT 64

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, G16E, E35D, M36I, R41K, R57K, Q61N, E65D, I72T, L89M  
>80397| codons 1-99
PQITLWQRPVVTIKVEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIDICGHKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y K219Q     E28D, V35I, T39A, I135L, S162C, E169D, K173A, Q174K, I178L, T200A, Q207E, H208Y, R211K  
>80397| codons 28-233
DEKIKALIEICAELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDF
WEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSLNNETPGIRYQYN
VLPQGWKGSPAIFQCSMTKILDPFRAKNPDLVIYQYMDDLYVGSDLEIGQHRAKIEELRE
YLLKWGFYTPDQKHQKEPPFLWMGYE

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005