<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR011 10101 Brazil 2001 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 306
2 3TC+ AZT 37

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V90I, I142V, K166R, R211K, V245EK  
>10101| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T4TI, L5LF, T12PS, I13V, K14R, G16GE, E35D, M36I, N37ND, R41K, D60E, I64V  
>10101| codons 2-92
QIIFWQRPLVPVRIEGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYEQ
ILVEICGHKAIGTVLVGPTPVNIIGRNLLTQ

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005