<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR03 2900 Brazil 2000 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT 28
2 AZT+ 3TC+ NFV 27
3 D4T+ DDI+ RTV+ SQV 21
4 None 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14KR, I15V, L19I, K20KR, E35D, M36I, N37E, R41RK, R57K, Q61DN, E65D, L89LM, I93IL  
>2900| codons 1-99
PQITLWQRPLVTIRVGGQIREALLDTGADDTVLEDIELPGKWKPKMIGGIGGFIKVKQYD
DILIDICGHKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6Q, V35T, T39L, W88C, K122E, I135L, I142V, S162HY, K173T, Q174K, E203ED, R211K, F214FL, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, P294PS, E297A, L301LM  
>2900| codons 1-324
PISPIQTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSLNNETPGVRYQYNVLPQGWKGSPAIFQHSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRTKIDELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVSLTAEAE
MELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005