<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR048 13100 Brazil 2000 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, I15V, E35D, R41K, R57K, Q61N, E65D, C67CW, A71AG, I72V, V77I, L89M  
>13100| codons 9-99
PLVNIKVGGQLKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVKQYDNILIDIWG
HKGVGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I2L, K49R, T69TI, K122A, I135T, K166R, E169D, D177E, G196E, F214L, T216TP, V245MR  
>13100| codons 2-247
LSPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPVF
AIKKKDSIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
ADFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILDPFRKQNPEIVIY
QYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGLTPPDKKHQKEPPFLWMGYELHPDKWTV
QPIMLP

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005