<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR029 5402 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 47
2 3TC+ D4T+ NFV 78
3 RTV+ SQV+ AZT+ 3TC 47

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215F K219Q     K20R, E28K, K32E, V111X, V118I, K122E, I135T, V179I, Q197H, H208Y, R211K, D218E, L228H, V245M, A272X, K277R, L283I, I293V, P294S, E297K  
>5402| codons 1-306
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIEALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDXGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGHHRTKIEELRQYLWKWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYXGIKVRQLCKLIRGTKALTEVVSLTKEAE
LELAEN

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003