<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR045 11800 Brazil 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI 37
2 ABC+ 3TC+ AZT 8
3 IDV+ 3TC+ DDI+ RTV 21

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210*W, T215Y K219N     E6D, T39N, K43E, E44A, A98AP, V118I, K122E, I135T, V179I, T200TA, H208Y, R211K, K223Q, V245T D110DN
>11800| codons 2-249
ISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICNELEEAGKISKIGPENPYNTPVF
AIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPPGLKKKKSVTVLNVGDAYFSIPLD
EDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIIIY
QYVDDLYVGSDLEIGQHRAKIEELRQYLWKWGFYTPDNKHQQEPPFLWMGYELHPDKWTV
QPITLPEK

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005