<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR028 4800 Brazil 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT 72
2 Unknown 25
3 NFV+ DDC+ AZT 42

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54V, V82A, L90M Q58E L10I, T12P, K14R, K55R, R57K, L63P, A71V, V77I, I93L, C95CF  
>4800| codons 1-99
PQITLWQRPIVPIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVRVKEYD
QIPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y K219Q     T39A, K122E, D123S, I135T, K166KR, E169D, D177E, T200A, I202V, H208HY, D218E, V245M, A272P, K277R, I293V, P294T, E297A, K311R, V317E  
>4800| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILDPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKVEELRQYLLRWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVTLTAEAE
LELAENREILREPVHGEYYDPSKD

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005