<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR027 4502 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 30
2 D4T+ 3TC+ IDV 202

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I L10I, K20R, E35D, M36I, R41K, R57K, Q61N, I62V, T74S, L89M  
>4502| codons 1-99
PQITLWQRPIVTIKIGGQLREALIDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYD
NVLIEICGHKAIGSVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y V75M     P4S, V35T, T39L, E44D, V90I, V118I, K122E, I135V, S162Y, E169D, K173A, Q174K, Q207E, R211K, V245Q, E248D, A272P, K277R, T286A, E291D, V292I, I293V, E297T, V317A  
>4502| codons 1-335
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTTEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005