<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR024 3902 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI NA
2 Unknown 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
V75M, Q151M, M184V F77L, F116Y K101E, K103N, G190A   K20R, K22R, S68G, K102Q, S105T, K122E, I135T, E138A, S162C, F214L, D218E, V245M, A272P, K277R, A288S, I293V, E300EK  
>3902| codons 1-321
PISPIETVPVKLKPGMDGPRVRQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLMDLRELNKRTQDFWEVQLGIPHPAGLEQNKTVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSTNNATPGIRYQYNVLPMGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGLTTPEKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKSLTEVVPLTEEAK
LELAENREILKEPVHGVYYDP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12I, I15V, E35D, M36I, R41K, R57K, Q61N, L63A, I93L  
>3902| codons 1-99
PQITLWQRPLVIIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NIAIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rodrigues, R Prevalence of ARV resistance mutations and impact of genotyping test in HIV patients with advance disease in Sao Paulo, Brazil. J Clin Virol, 2005