<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1263 CA3128 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 AZT+DDI 52
3 DDI 96
4 D4T 9
5 3TC+AZT 39
6 3TC+AZT+IDV 60
7 3TC+AZT+RTV+SQV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36IL, R57K, L63P, A71T, I72M, V77I  
>CA3128| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEELNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKTMGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML T215CG     T39A, I142V, S162C, Q207E, V245VI  
>CA3129| codons 1-263
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFGTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPEKDSWTVNDIQKLVGK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005