<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1260 CA3122 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 130
2 AZT+DDC 26
3 DDI 30
4 Unknown 57
5 3TC+AZT 13
6 3TC+AZT+SQV 26
7 3TC+D4T+SQV 61
8 3TC+D4T+NFV 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82VA, L90M   L10I, L63P, A71V, V77I, I93L  
>CA3122| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD
QIPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F V75VA, K219Q Y188L   V35M, T39A, K49R, K64Y, V118I, D123E, S162D, T165I, E169D, D177E, V179I, G196E, I202V, E203ED, Q207H, R211K, F214L, D218E, L228H, A272P, T286A, E297K  
>CA3121| codons 1-298
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAEMEKEGKISRIGPENPYNTPV
FAIYKKNSTRWRKLADFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMIKILDPFRKQNPEIII
YQYVDDLLVGSDLEIEQHRTKVDELRHHLLKWGLFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005