<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL34147 65713 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ DDI+ AZT NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L23I I13V, K14R, K20I, E35G, M36I, R41K, H69K, T74S, V82I, L89I, Q92K  
>65713| codons 1-99
PQITLWQRPLVTVRIGGQLIEAILDTGADDTVLEGINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPINIIGRNILTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, T215Y       V35T, V60I, D67X, A98S, K122E, D123S, S162C, Q174E, D177E, T200A, Q207K, R211S, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, I329V L310LM
>65713| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKXSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKENPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLSWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREIMKEPVHGVYYDPSKDLIAEVQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005