<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL36922 69089 Portugal 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+NVP 78
2 D4T+3TC+NFV 143

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215I, K219E G190A   P4S, V35T, E36D, K43R, W88C, S134R, I135V, I142V, S162A, K173IV, Q174K, D177E, T200A, Q207E, R211K, F214L, K238KE, V245Q, K281R, T286A, E291D, V292I, I293V, P294T, S322T  
>69089| codons 1-334
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEREGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPRVNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPEIVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLKWGLITPDEKHQKEPPFLWMGYELHPDEWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005