<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL40184 68632 Portugal 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 RTI NA
2 D4T+DDC 31
3 ATV+DDC+TDF 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10IV, T12I, I13V, K14R, G16E, E35D, M36I, R41K, R57RK, H69K, L89M  
>68632| codons 1-99
PQITLWQRPIVIVRIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215Y   K103N   V35X, E36D, K49KR, V60VI, S68SG, V90VI, D123E, I132IV, I135V, E138Q, S162A, K173T, Q174E, D177E, T200A, Q207X, V245Q, A272P, K275R, E291D, V292I, I293V, P294PT, E312N, I326V  
>68632| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALXDICTELEKEGKISRIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTVPSVNNQTPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTENPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRXHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLRGTKALTDIVTLTEEAE
LELAENREILKNPVHGVYYDPSKDLVAEIQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005