<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL40147 68564 Portugal 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NVP 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M   Y181C   V35T, V60I, S68G, A98S, K122E, D123S, I135R, K173R, Q174K, D177E, T200A, I202V, Q207QK, R211K, F214FL, H221HY, V245Q, E248D, D250E, A272P, L283I, T286TA, E291D, V292I, I293V, D324E, L325I, I326V, I329V  
>68564| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKRKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRRKNPEIVI
CQYMDDLYVGSDLEIGQHRAKVEELRKHLLKWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKEIVAEVQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005