<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL28285 67988 Portugal 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 EFV+ TDF+ D4T NA
2 ATV+ IDV+ DDC+ AZT NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L33LF, L89V L10V, I13V, K14R, G16E, K20IM, E35EG, M36I, R41K, Q61H, C67Y, G68D, H69K, A71T, I72R  
>67988| codons 1-99
PQITLWQRPVVTVRIEGQLIEALLDTGADDTVFEGINLPGKWKPKMIGGIGGFIKVRQYD
HILIEIYDKKTRGTVLVGPTPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184MV A62V, D67G, V75I, F116Y, K219E Y181C   K11Q, A33V, V35T, E36D, K49R, V60I, S68G, D121H, K122E, D123S, I135V, S162A, K173T, Q174R, D177E, T200A, I202V, Q207E, R211K, F214L, V245K, A272P, K277R, T286A, A288T, E291D, V292I, I293V, P294T, S322T, I326V  
>67988| codons 1-333
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKVLTDICTEMEKEGKISRIGPENPYNTPI
FVIKKKGGTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
HESFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQASMTKILEPFRTRNPEIVI
CQYVDDLYVGSDLEIGQHRAKVEELREHLLKWGLTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKTLTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005