<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL37859 63507 Portugal 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 176

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q     V21I, K32R, V35T, T39A, V60I, K122E, D123S, I135V, S162A, R172RK, K173T, Q174K, D177E, I178M, Q197K, T200A, Q207E, V245Q, E248D, T286A, V292I, I293V, E297A, E312EQ  
>63507| codons 1-319
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIRALTEICAEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFKTKNPEMVI
YQYMDDLYVGSDLEIGKHRAKIEELREHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIVPLTAEAE
LELAENREILKQPVHGVYY

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005