<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA641 CA3114 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 AZT+DDI 117
3 3TC+AZT 31
4 3TC+AZT+IDV 26
5 3TC+D4T+IDV 27
6 3TC+D4T+RTV+SQV 3

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, T69AD, M184V, L210W, T215Y       K20KR, V35M, T39S, K43E, E44D, V111VI, V118I, K122E, T200A, E203K, Q207D, H208Y, R211K, K223E, L228HR, A272P, K277R  
>CA3114| codons 1-278
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICSELEEDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIKELRDYLWKWGFYTPDKKHQEEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, V82VA L33IV L10I, N37C, L63P, A71AV  
>CA3113| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVVEEMCLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005