<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL31506 70211 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT NA
2 EFV+ 3TC+ AZT NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13AV, K14KR, I15X, K20I, E35D, M36I, R41K, H69K, V82I, L89M  
>70211| codons 1-99
PQITLWQRPLVTARXGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20KR, E28EK, K32KE, V35T, E40X, K43R, V60I, A98S, K122E, D123S, K173I, Q174K, D177E, Q207K, R211S, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293IV, E297A  
>70211| codons 1-318
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIEALTEICTDMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVY

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005