<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL39805 67858 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 47
2 D4T+3TC+NFV 117

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M   I13V, K14R, K20IT, E35DN, M36I, R41K, H69K, V82I, L89I  
>67858| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNIMTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005