<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RenG16052 RenG16052 Brazil 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R57K, L63P, E65D, K70R, V77VI, L89M  
>RenG16052| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYDQIP
IDICGHRAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M F116Y K103N, Y181YC   V60I, S68G, T69N, L109LM, K122E, D123E, Q207E, F214L, V245M Y188Y*
>RenG16052| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVMDVGDAYYSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDL*VGSDLEIGQHRTKIEELREHLLRWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Diaz, RS The virological and immunological characteristics of the HIV-1-infected population in Brazil: from initial diagnosis to impact of antiretroviral use. PLoS ONE, 2015