<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL8468 67575 Portugal 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC+RTV 74
2 None 147
3 DDI+ABC+EFV 34

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115YF, M184V T215D K103N V179E E28K, K32E, V35T, K43R, V60I, S68G, A98S, K122E, D123S, I135T, K173I, Q174K, D177E, T200A, Q207K, R211S, V245Q, E248D, D250E, A272P, K277R, T286A, E291D, V292I, I293V, E297AV, D320E, D324E, I329V  
>67575| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTEICTEMEREGKISKIGPENPYNTPI
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAFFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIEI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFDTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYEPSKELIAEVQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005