<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL39761 67781 Portugal 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 104
2 None 213
3 D4T+3TC+NVP 82

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C   V35T, T39L, K43R, A98S, K102KR, K122E, D123N, I135IT, A158T, K173I, Q174K, D177E, T200A, Q207K, R211S, K238KR, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297T, E312Q, D320E, D324E, I329V  
>67781| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEREGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKRKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPTIFQSSMTKILEPFRIKNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTTEAE
LELAENREILKQPVHGVYYEPSKELIAEVQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005