<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL38655 65229 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 RTV+ IDV+ EFV+ ABC+ 3TC+ DDI+ NFV+ AZT NA
2 EFV+ 3TC+ AZT NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, K20I, E35N, M36I, R41K, L63C, H69K, V82I, L89M  
>65229| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QICIEICGKKAIGTVLVGPTPINIIGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   K20R, V21I, V35T, K43R, V60I, A98S, K122E, D123N, I135T, K166R, K173I, Q174K, D177E, I178M, T200A, Q207K, R211S, V245Q, E248D, D250E, A272P, K277R, T286A, E291D, V292I, I293V, E297A, D320E, S322T, D324E, I329V, Q334P  
>65229| codons 1-335
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALTEICTEMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYEPTKELIAEVQKQGPG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005