<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL38151 64138 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ D4T NA
2 NVP+ 3TC+ D4T NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215V, K219E K103N K238T V35T, V60I, T69N, A98S, K122E, D123S, I135T, K173IT, Q174K, D177E, T200AS, E203ED, Q207K, R211NS, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, D324E, I329V  
>64138| codons 1-332
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIDELRKHLLNWGFVTPDEKHQKEPPFLWMGYELHPDTWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005