<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL38448 64783 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ 3TC+ DDI+ D4T NA
2 NFV+ 3TC+ AZT NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V D67DG, K219Q K103N   K20KR, V35T, E40D, V60I, T69N, A98S, K122E, D123S, I135L, S162A, K173R, Q174K, N175Y, D177E, T200A, E203EK, Q207E, R211N, L228H, V245Q, E248D, D250E, A272P, T286A, A288T, E291D, V292I, I293V, E297A, D324E, I329V  
>64783| codons 1-333
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKGSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRRKYPEIVI
YQYVDDLYVGSDLEIGQHRAKIKELREHLLNWGFTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKTLTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, K14R, K20I, E35EG, M36I, R41K, D60E, L63P, H69K, T74S, V82I, L89M, I93L  
>64783| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEGINLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGKKAIGSVLVGPTPINIIGRNMMTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005