<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL8813 64115 Portugal 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+SQV 104
2 None 13
3 D4T+3TC+NVP+NFV 135

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, T215Y K219E Y181C   T7P, V35T, K43R, V60I, A98S, K122E, D123S, I135T, T139TI, K173IR, Q174K, D177E, T200A, E203D, Q207K, R211NS, D218E, V245Q, E248D, D250E, A272P, T286A, V292I, I293V, E297A, D320E, D324E, I329V  
>64115| codons 1-334
PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEREGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNEIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
CQYVDDLYVGSDLEIGQHRAKIDELRKHLLNWGFYTPEEKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVPLTAEAE
LELAENREILKEPVHGVYYEPSKELIAEVQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005