Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA624 | CA3096 | U.S. | 1997 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | DDI | 209 |
| 2 | 3TC+D4T | 117 |
| 3 | 3TC+AZT+NFV | 28 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| D30N | N88D | I13V, E35D, M36I, L63P |
| >CA3096| codons 1-99 PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYD QIPIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF |
References
| Author | Title | Citation |
| Zolopa, AR | HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. | Ann Intern Med, 1999 |
| Rhee, SY | Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. | AAC, 2004 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |