<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA624 CA3096 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 209
2 3TC+D4T 117
3 3TC+AZT+NFV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13V, E35D, M36I, L63P  
>CA3096| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005