<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL19454 63189 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 31
2 ABC+EFV+LPV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48GV, I54V, L90M L89V T4TS, L10LV, I13V, K14R, K20I, M36I, N37D, R41EK, I62V, H69K, A71V, T74S, V82X  
>63189| codons 1-99
PQISLWQRPVVTVRIGGQLIEALLDTGADDTVLEEIDLPGEWKPKLIVGIGGFVKVRQYD
QVLIEICGKKVIGSVLVGPTPXNIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, L74V, L210W, T215Y   K103N, Y181C, G190A F227FL L34LI, V35T, T39L, V60I, A98S, K101KQ, K122E, D123NS, K173R, Q174N, D177E, T200A, Q207G, R211K, H221HY, K223KE, V245T, D250E, A272P, T286A, E291D, V292I, I293V, E297T, A304E  
>63189| codons 1-318
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKAITEICLELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPSGLQKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRNNPEIVI
CQYMDDLYVASDLEIGQHRAKIEELRGHLWKWGFYTPDKKYQEEPPLLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTTEAE
LELEENREILKEPVHGVY

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005