<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL31260 62984 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 43
2 AZT+DDI+3TC 30
3 D4T+3TC+IDV 208

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82S L89V L10LI, I13V, I15V, L19LP, K20I, E35D, M36I, N37ND, R41K, I62IV, L63LP, H69K, K70KR, A71V  
>62984| codons 1-99
PQITLWQRPIVTVKVGGQPIEALLDTGADDTVLEDIDLPGKWKPKIIGGIGGFVKVRQYD
QVPIEICGKRVIGTVLVGPTPSNIIGRNVLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005