<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL25290 62869 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT NA
2 SQV+ 3TC+ D4T NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, T215Y K219E     V35T, V60I, S68G, A98S, K102R, K122E, D123S, I135V, K166R, K173T, Q174AE, D177E, T200A, Q207K, R211S, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, D320E  
>62869| codons 1-322
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNGTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKRKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTANPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYEPS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, K20I, E35D, M36I, N37NS, R41K, L63P, H69K, K70R, A71AV, V82I, L89M  
>62869| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDISLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRVIGTVLVGPTPINIIGRNMMTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005