<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL37290 62297 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 95
2 D4T+3TC+NFV 114

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70KR, M184V, T215Y     V179E V35T, E40ED, K43R, V60I, A98S, K122E, D123S, I135X, E138A, S162N, K173I, Q174K, T200A, Q207EK, R211NS, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297T  
>62297| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDLEREGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSXNNATPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRIKNPDIEI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLNWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTTEAE
LELAENREILK

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005