<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL26473 63176 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ SQV+ RTV+ IDV+ EFV+ 3TC+ DDI+ AZT NA
2 3TC+ LPV+ ABC NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F, L90M L89V L10I, I13V, K14R, K20I, E35N, M36I, N37ND, R41K, L63P, H69K, A71V, Q92QK  
>63176| codons 1-99
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFVKVRQYD
QIPIEICGKKVIGTVLVGPTPFNIIGRNVMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, M184V, T215F K219Q L100I, K103N   V35T, S48SL, V60I, A98S, K122E, D123S, I135T, K173I, Q174K, D177E, T200A, Q207K, R211S, D218DE, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, L301M  
>63176| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKILKIGPENPYNTPI
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPSGIKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
MELAENREILKEPVHGVYY

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005